Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GPR157 protein

This Human GPR157 protein spans the amino acid sequence from region 1-335aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GPR157G-protein coupled receptor 157

UniProt

Q5UAW9

Expression Region

1-335aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc finger protein 69 (ZNF69) Human ELISA Kit
I3848 96 Tests

Zinc finger protein 69 (ZNF69) Human ELISA Kit

Sign In for Pricing
View Details
Beta-Dihydrothevinone
TRC-D449843-1MG 1 mg

Beta-Dihydrothevinone

Sign In for Pricing
View Details
Delphinidin 3-glucoside chloride
orb2279176-01 1 mg

Delphinidin 3-glucoside chloride

Sign In for Pricing
View Details
Delphinidin 3-glucoside chloride
orb2279176-02 5 mg

Delphinidin 3-glucoside chloride

Sign In for Pricing
View Details
Mouse SDC1 Protein, His Tag
E40MOP1580 20 µg

Mouse SDC1 Protein, His Tag

Sign In for Pricing
View Details
HER4 Blocking Peptide
CBP3925-01 1 mg

HER4 Blocking Peptide

Sign In for Pricing
View Details