Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria lgt protein

This Bacteria lgt protein spans the amino acid sequence from region 1-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lgt, LL0619, L5776Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase, EC 2.5.1.145

UniProt

Q9CHU9

Expression Region

1-261aa

Tag

C-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bak (A2) polyclonal antibody
orb642540-01 25 µL

Bak (A2) polyclonal antibody

Sign In for Pricing
View Details
Bak (A2) polyclonal antibody
orb642540-02 50 μL

Bak (A2) polyclonal antibody

Sign In for Pricing
View Details
Bak (A2) polyclonal antibody
orb642540-03 100 µL

Bak (A2) polyclonal antibody

Sign In for Pricing
View Details
Bak (A2) polyclonal antibody
orb642540-04 200 µL

Bak (A2) polyclonal antibody

Sign In for Pricing
View Details
CHP (Calcium Binding Protein P22, SLC9A1BP) (HRP)
MBS6181422-01 0.1 mL

CHP (Calcium Binding Protein P22, SLC9A1BP) (HRP)

Sign In for Pricing
View Details
CHP (Calcium Binding Protein P22, SLC9A1BP) (HRP)
MBS6181422-02 5x 0.1 mL

CHP (Calcium Binding Protein P22, SLC9A1BP) (HRP)

Sign In for Pricing
View Details