Human GP1BB protein
This Human GP1BB protein spans the amino acid sequence from region 26-206aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Antigen CD42b-beta CD_antigen, CD42c
UniProt
P13224
Expression Region
26-206aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
39.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A07337-3-Fluoro647 100 µg/Vial
Anti-PFKP Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details 
MBS7211530-01 48 Well
Human Olfactory receptor 1D5 (OR1D5) ELISA Kit
Sign In for Pricing
View Details MBS7211530-02 96 Well
Human Olfactory receptor 1D5 (OR1D5) ELISA Kit
Sign In for Pricing
View Details MBS7211530-03 5x 96 Well
Human Olfactory receptor 1D5 (OR1D5) ELISA Kit
Sign In for Pricing
View Details MBS7211530-04 10x 96 Well
Human Olfactory receptor 1D5 (OR1D5) ELISA Kit
Sign In for Pricing
View Details