Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria yopE protein

This Bacteria yopE protein spans the amino acid sequence from region 1-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YopE, yop25, Outer membrane virulence protein YopE

UniProt

P31492

Expression Region

1-219aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Yersinia enterocolitica

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD9 Antibody
orb352690-01 50 μL

CARD9 Antibody

Sign In for Pricing
View Details
CARD9 Antibody
orb352690-02 100 µL

CARD9 Antibody

Sign In for Pricing
View Details
GIPC3 Rabbit Polyclonal Antibody
orb183855-01 50 μL

GIPC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GIPC3 Rabbit Polyclonal Antibody
orb183855-02 100 µL

GIPC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GIPC3 Rabbit Polyclonal Antibody
orb183855-03 200 µL

GIPC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lmo2 ORF Vector (Mouse) (pORF)
ORF049241 1.0 µg DNA

Lmo2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details