Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MIF) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (Phenylpyruvate tautomerase)

UniProt

P14174

Expression Region

2-115aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml.

Form

Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP1P2 CRISPRa sgRNA lentivector (set of three targets)(Human)
36030121 3x 1.0µg DNA

PARP1P2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Gabbr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7549806 1.0 µg DNA

Gabbr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Phospho-NOS3 (T494) Antibody
A33579-50UG 50 µg

Phospho-NOS3 (T494) Antibody

Sign In for Pricing
View Details
Recombinant Human V-Set and Ig Domain-Containing Protein 2/VSIG2 (C-6His)
C548-50ug 50 µg

Recombinant Human V-Set and Ig Domain-Containing Protein 2/VSIG2 (C-6His)

Sign In for Pricing
View Details
DCAF1 Knockout Raji Polyclonal Cells
ARG1365 1 Million

DCAF1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
LBX1 Rabbit Polyclonal Antibody
E28PN1430 100 µL

LBX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details