Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MIF) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (Phenylpyruvate tautomerase)

UniProt

P14174

Expression Region

2-115aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml.

Form

Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LMBRD2 Antibody
NBP3-06641-100ul 100 µL

Rabbit Polyclonal LMBRD2 Antibody

Sign In for Pricing
View Details
Hydantoic acid
OR74110-01 5 g

Hydantoic acid

Sign In for Pricing
View Details
Hydantoic acid
OR74110-02 500 g

Hydantoic acid

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLC25A6 (Solute carrier family 25 member 6) Full Length
MPC1315K Each

Magic™ Membrane Protein Human SLC25A6 (Solute carrier family 25 member 6) Full Length

Sign In for Pricing
View Details
FOXJ3 Protein Vector (Mouse) (pPB-C-His)
PV180106 500 ng

FOXJ3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Agar, high gel strength
GK9085-250g 250 g

Agar, high gel strength

Sign In for Pricing
View Details