Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRY2 protein

This Human CRY2 protein spans the amino acid sequence from region 1-593aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA0658

UniProt

Q49AN0

Expression Region

1-593aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat TNF alpha ELISA Kit
orb1216472-01 1 set (1 x capture antibody)

Goat TNF alpha ELISA Kit

Sign In for Pricing
View Details
Goat TNF alpha ELISA Kit
orb1216472-02 1 set (2 x capture antibody)

Goat TNF alpha ELISA Kit

Sign In for Pricing
View Details
DPF2 Polyclonal Antibody
ABP51197-01 30 µL

DPF2 Polyclonal Antibody

Sign In for Pricing
View Details
DPF2 Polyclonal Antibody
ABP51197-02 100 µL

DPF2 Polyclonal Antibody

Sign In for Pricing
View Details
DPF2 Polyclonal Antibody
ABP51197-03 200 µL

DPF2 Polyclonal Antibody

Sign In for Pricing
View Details
GIT2 (G Protein-Coupled Receptor Kinase Interacting ArfGAP 2, CAT-2, DKFZp686G01261, KIAA0148, MGC760) (APC)
MBS6166247-01 0.1 mL

GIT2 (G Protein-Coupled Receptor Kinase Interacting ArfGAP 2, CAT-2, DKFZp686G01261, KIAA0148, MGC760) (APC)

Sign In for Pricing
View Details