Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRY2 protein

This Human CRY2 protein spans the amino acid sequence from region 1-593aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA0658

UniProt

Q49AN0

Expression Region

1-593aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Calponin 1 Antibody (CNN1/4227R) [Alexa Fluor 405]
NBP3-08462AF405 100 µL

Rabbit Monoclonal Calponin 1 Antibody (CNN1/4227R) [Alexa Fluor 405]

Sign In for Pricing
View Details
Human Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) ELISA Kit
abx551329 96 Tests

Human Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) ELISA Kit

Sign In for Pricing
View Details
RNASET2 Recombinant Protein
OPCD06726-200UG 200 µg

RNASET2 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human CCDC3 shRNA (UAS) - Lentiviral human CCDC3 shRNA (UAS, RFP) (25)
GTR15082739 1 Vial

Lentiviral human CCDC3 shRNA (UAS) - Lentiviral human CCDC3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CLDN17 Protein Vector (Mouse) (pPB-N-His)
PV165955 500 ng

CLDN17 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum tam Protein (aa 1-255)
VAng-Yyj4019-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Gilvum tam Protein (aa 1-255)

Sign In for Pricing
View Details