Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BSG protein

This Human BSG protein spans the amino acid sequence from region 138-323aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood group), Basigin, Blood brain barrier HT7 antigen, Bsg, CD 147, CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M 6, M6, M6 leukocyte activation antigen, Neurothelin, OK, OK blood group, OK blood group antigen, TCSF, Tumor cell derived collagenase stimulatory factor, Tumor cell-derived collagenase stimulatory factor

UniProt

P35613

Expression Region

138-323aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4 (Acetyl Lys5) Polyclonal Antibody
MBS8519146-01 0.1 mg

Histone H4 (Acetyl Lys5) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys5) Polyclonal Antibody
MBS8519146-02 0.1 mL (AF635)

Histone H4 (Acetyl Lys5) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys5) Polyclonal Antibody
MBS8519146-03 0.1 mL (AF610)

Histone H4 (Acetyl Lys5) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys5) Polyclonal Antibody
MBS8519146-04 0.1 mL (AF405S)

Histone H4 (Acetyl Lys5) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys5) Polyclonal Antibody
MBS8519146-05 0.1 mL (AF405L)

Histone H4 (Acetyl Lys5) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys5) Polyclonal Antibody
MBS8519146-06 0.1 mL (AF546)

Histone H4 (Acetyl Lys5) Polyclonal Antibody

Sign In for Pricing
View Details