Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD28 protein

This Human CD28 protein spans the amino acid sequence from region 19-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP44 (CD_antigen, CD28)

UniProt

P10747

Expression Region

19-152aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS25 (NM_032353) Human Tagged ORF Clone Lentiviral Particle
RC202487L4V 200 µL

VPS25 (NM_032353) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 550)
MBS6315004-01 0.1 mL

L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 550)

Sign In for Pricing
View Details
L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 550)
MBS6315004-02 5x 0.1 mL

L1TD1, CT (L1TD1, ECAT11, LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11) (MaxLight 550)

Sign In for Pricing
View Details
Porcine Actin binding LIM protein 2 (ABLIM2) ELISA Kit
GTR10343736 96 Well

Porcine Actin binding LIM protein 2 (ABLIM2) ELISA Kit

Sign In for Pricing
View Details
PCMV-TRIM5 (human) -3xFLAG-Neo
BZ61759 1 Vial

PCMV-TRIM5 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
XTP3TPA Peptide - N-terminal region (AAP46328)
AAP46328-100UG 100 µg

XTP3TPA Peptide - N-terminal region (AAP46328)

Sign In for Pricing
View Details