Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD28 protein

This Human CD28 protein spans the amino acid sequence from region 19-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP44 (CD_antigen, CD28)

UniProt

P10747

Expression Region

19-152aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g61620 Polyclonal Antibody
MBS7186488 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g61620 Polyclonal Antibody

Sign In for Pricing
View Details
TSC22D1 Polyclonal Antibody
A61538-020 20 µL

TSC22D1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV652906 1.0 µg DNA

SLC6A18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lysophosphatidylcholine Acyltransferase 3 (LPCAT3) Antibody (Biotin)
abx314538-01 20 µg

Lysophosphatidylcholine Acyltransferase 3 (LPCAT3) Antibody (Biotin)

Sign In for Pricing
View Details
Lysophosphatidylcholine Acyltransferase 3 (LPCAT3) Antibody (Biotin)
abx314538-02 50 µg

Lysophosphatidylcholine Acyltransferase 3 (LPCAT3) Antibody (Biotin)

Sign In for Pricing
View Details
Lysophosphatidylcholine Acyltransferase 3 (LPCAT3) Antibody (Biotin)
abx314538-03 100 µg

Lysophosphatidylcholine Acyltransferase 3 (LPCAT3) Antibody (Biotin)

Sign In for Pricing
View Details