Human CTAG1A protein

CTAG1A, CTAG1B, Autoimmunogenic cancer/testis antigen NY ESO 1, Autoimmunogenic cancer/testis antigen NY-ESO-1, Cancer antigen 3, Cancer/testis antigen 1, Cancer/testis antigen 1B , Cancer/testis antigen 6.1, CT6.1, CTAG 1, CTAG 1B, CTAG, CTAG1, CTAG1B, CTG1B_HUMAN, ESO 1, ESO1, L antigen family member 2, LAGE 2, LAGE 2 protein, LAGE 2B, LAGE-2, LAGE2, LAGE2 protein, LAGE2A, LAGE2B, New York esophageal squamous cell carcinoma 1, NY ESO 1, NYESO 1, NYESO1

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR