Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTAG1A protein

This Human CTAG1A protein spans the amino acid sequence from region 1-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTAG1A, CTAG1B, Autoimmunogenic cancer/testis antigen NY ESO 1, Autoimmunogenic cancer/testis antigen NY-ESO-1, Cancer antigen 3, Cancer/testis antigen 1, Cancer/testis antigen 1B , Cancer/testis antigen 6.1, CT6.1, CTAG 1, CTAG 1B, CTAG, CTAG1, CTAG1B, CTG1B_HUMAN, ESO 1, ESO1, L antigen family member 2, LAGE 2, LAGE 2 protein, LAGE 2B, LAGE-2, LAGE2, LAGE2 protein, LAGE2A, LAGE2B, New York esophageal squamous cell carcinoma 1, NY ESO 1, NYESO 1, NYESO1

UniProt

P78358

Expression Region

1-180aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cryptomeria japonica Sugi basic protein
orb1652516-01 20 µg

Recombinant Cryptomeria japonica Sugi basic protein

Sign In for Pricing
View Details
Recombinant Cryptomeria japonica Sugi basic protein
orb1652516-02 100 µg

Recombinant Cryptomeria japonica Sugi basic protein

Sign In for Pricing
View Details
Recombinant Cryptomeria japonica Sugi basic protein
orb1652516-03 1 mg

Recombinant Cryptomeria japonica Sugi basic protein

Sign In for Pricing
View Details
EMR1 (MaxLight 490)
MBS6253836-01 0.1 mL

EMR1 (MaxLight 490)

Sign In for Pricing
View Details
EMR1 (MaxLight 490)
MBS6253836-02 5x 0.1 mL

EMR1 (MaxLight 490)

Sign In for Pricing
View Details
Anti-TGF alpha/TGFA Antibody Picoband®, Dylight594 Conjugate
PA1360-Dylight594 100 µg

Anti-TGF alpha/TGFA Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details