Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tectb protein

This Mouse Tectb protein spans the amino acid sequence from region 18-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tectb, Beta-tectorin

UniProt

O08524

Expression Region

18-305aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RPL31 Antibody Picoband® Cy3 Conjugated
A07002-2-Cy3 100 µg/Vial

Anti-RPL31 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
UBE2R2 Peptide - C-terminal region
orb2006354 100 µg

UBE2R2 Peptide - C-terminal region

Sign In for Pricing
View Details
Hoxd4 Antibody - N-terminal region
ARP39115_P050-25UL 25 µL

Hoxd4 Antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Lactuca sativa Photosystem II D2 protein (psbD)
MBS7027623-01 0.02 mg

Recombinant Lactuca sativa Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details
Recombinant Lactuca sativa Photosystem II D2 protein (psbD)
MBS7027623-02 0.1 mg

Recombinant Lactuca sativa Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details
Recombinant Lactuca sativa Photosystem II D2 protein (psbD)
MBS7027623-03 5x 0.1 mg

Recombinant Lactuca sativa Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details