Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tectb protein

This Mouse Tectb protein spans the amino acid sequence from region 18-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tectb, Beta-tectorin

UniProt

O08524

Expression Region

18-305aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAV20 sgRNA CRISPR Lentivector (Human) (Target 2)
K2530003 1.0 µg DNA

TRNAV20 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human beta-Glucuronidase/GUSB (NP_000172.2) VersaClone cDNA
RDC3718 10 µg

Human beta-Glucuronidase/GUSB (NP_000172.2) VersaClone cDNA

Sign In for Pricing
View Details
anti-S100 Calcium Binding Protein A13
YF-PA24654 50 ul

anti-S100 Calcium Binding Protein A13

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ywoB (ywoB)
orb2920742-01 20 µg

Recombinant Bacillus subtilis Uncharacterized protein ywoB (ywoB)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ywoB (ywoB)
orb2920742-02 100 µg

Recombinant Bacillus subtilis Uncharacterized protein ywoB (ywoB)

Sign In for Pricing
View Details
DDR2 (NM_001014796) Human Recombinant Protein
TP308745 20 µg

DDR2 (NM_001014796) Human Recombinant Protein

Sign In for Pricing
View Details