Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD81 protein

This Human CD81 protein spans the amino acid sequence from region 113-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

26 kDa cell surface protein TAPA-1 (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD_antigen, CD81) (TAPA1) (TSPAN28)

UniProt

P60033

Expression Region

113-201aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR17-1 Rat qPCR Template Standard (MI0000845)
RK300067 200 Reactions

MIR17-1 Rat qPCR Template Standard (MI0000845)

Sign In for Pricing
View Details
violetFluor 450 Anti-Human CD4 (RPA-T4)
MBS4165765-01 100 Tests

violetFluor 450 Anti-Human CD4 (RPA-T4)

Sign In for Pricing
View Details
violetFluor 450 Anti-Human CD4 (RPA-T4)
MBS4165765-02 5x 100 Tests

violetFluor 450 Anti-Human CD4 (RPA-T4)

Sign In for Pricing
View Details
POLR2B 3'UTR Luciferase Stable Cell Line
TU018420 1.0 mL

POLR2B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 UPF0145 protein YbjQ (ybjQ)
MBS1393599-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 UPF0145 protein YbjQ (ybjQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 UPF0145 protein YbjQ (ybjQ)
MBS1393599-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 UPF0145 protein YbjQ (ybjQ)

Sign In for Pricing
View Details