Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD81 protein

This Human CD81 protein spans the amino acid sequence from region 113-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

26 kDa cell surface protein TAPA-1 (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD_antigen, CD81) (TAPA1) (TSPAN28)

UniProt

P60033

Expression Region

113-201aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urokinase Plasminogen Activator Surface Receptor (PLAUR) Antibody
abx404546-01 100 µL

Urokinase Plasminogen Activator Surface Receptor (PLAUR) Antibody

Sign In for Pricing
View Details
Urokinase Plasminogen Activator Surface Receptor (PLAUR) Antibody
abx404546-02 200 µL

Urokinase Plasminogen Activator Surface Receptor (PLAUR) Antibody

Sign In for Pricing
View Details
Urokinase Plasminogen Activator Surface Receptor (PLAUR) Antibody
abx404546-03 1 mL

Urokinase Plasminogen Activator Surface Receptor (PLAUR) Antibody

Sign In for Pricing
View Details
Gox Antibody
orb344169 25 µL

Gox Antibody

Sign In for Pricing
View Details
Mouse KLK7 ELISA Kit
E057717-01 1 Each

Mouse KLK7 ELISA Kit

Sign In for Pricing
View Details
Mouse KLK7 ELISA Kit
E057717-02 1 Each

Mouse KLK7 ELISA Kit

Sign In for Pricing
View Details