Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HAPLN2 protein

This Human HAPLN2 protein spans the amino acid sequence from region 27-340aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain link protein 1 (BRAL1)

UniProt

Q9GZV7

Expression Region

27-340aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDS Human Over-expression Lysate
orb1367543 20 µg

SDS Human Over-expression Lysate

Sign In for Pricing
View Details
CD25 (IL-2R Alpha Chain, Interleukin-2 Receptor Alpha Chain) (APC)
214615-APC 100 µL

CD25 (IL-2R Alpha Chain, Interleukin-2 Receptor Alpha Chain) (APC)

Sign In for Pricing
View Details
VTN Protein Vector (Human) (pPM-C-His)
PV045968 500 ng

VTN Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-MSK1 (Ser376) Rabbit Polyclonal Antibody (PerCP-Cy7)
orb2431982 100 µL

Phospho-MSK1 (Ser376) Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Kv4.2 Rabbit Polyclonal Antibody (AP)
orb958370 100 µL

Kv4.2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Microscope Slides Human Spinal Cord TS
4040900/21 1 Each

Microscope Slides Human Spinal Cord TS

Sign In for Pricing
View Details