Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HAPLN2 protein

This Human HAPLN2 protein spans the amino acid sequence from region 27-340aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain link protein 1 (BRAL1)

UniProt

Q9GZV7

Expression Region

27-340aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin 5, Human (Laminin gamma 2) discontinued
L1227-61 10 µg

Laminin 5, Human (Laminin gamma 2) discontinued

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)
MBS1226283-01 0.02 mg (E-Coli)

Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)
MBS1226283-02 0.02 mg (Yeast)

Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)
MBS1226283-03 0.1 mg (E-Coli)

Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)
MBS1226283-04 0.1 mg (Yeast)

Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)
MBS1226283-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus fermentum Ribonuclease Z (rnz)

Sign In for Pricing
View Details