Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus GPC protein

This Virus GPC protein spans the amino acid sequence from region 59-258aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pre-GP-C (GP-C)

UniProt

P17332

Expression Region

59-258aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Lassa virus (strain GA391) (LASV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LIYKGTYELQTLELNMETLNMTMPLSCTKNNSHHYIRVGNETGLELTLTNTSILNHKFCNLSDAHKRNLYDHSLMSIISTFHLSIPNFNQYEAMSCDFNGGKITVQYNLSHSFAVDAAGHCGTLANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWDDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clostridium botulinum Neurotoxin Type D Light Chain (Biotin)
MBS647408-01 0.05 mg

Clostridium botulinum Neurotoxin Type D Light Chain (Biotin)

Sign In for Pricing
View Details
Clostridium botulinum Neurotoxin Type D Light Chain (Biotin)
MBS647408-02 5x 0.05 mg

Clostridium botulinum Neurotoxin Type D Light Chain (Biotin)

Sign In for Pricing
View Details
KRT76 Antibody
orb2309678-01 20 µg

KRT76 Antibody

Sign In for Pricing
View Details
KRT76 Antibody
orb2309678-02 100 µg

KRT76 Antibody

Sign In for Pricing
View Details
KRT76 Antibody
orb2309678-03 100 ug (without BSA and Azide)

KRT76 Antibody

Sign In for Pricing
View Details
SAA1 Monoclonal Antibody
CSB-MA3657761A0m-01 50 µg

SAA1 Monoclonal Antibody

Sign In for Pricing
View Details