Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus GPC protein

This Virus GPC protein spans the amino acid sequence from region 59-258aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pre-GP-C (GP-C)

UniProt

P17332

Expression Region

59-258aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Lassa virus (strain GA391) (LASV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LIYKGTYELQTLELNMETLNMTMPLSCTKNNSHHYIRVGNETGLELTLTNTSILNHKFCNLSDAHKRNLYDHSLMSIISTFHLSIPNFNQYEAMSCDFNGGKITVQYNLSHSFAVDAAGHCGTLANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWDDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin I/II (5-8)
C03719-100mg 100 mg

Angiotensin I/II (5-8)

Sign In for Pricing
View Details
Caprisil CN HPLC Column, 3 µm, 100 Å, CY533-CN x 75 mm
CY533-CN 3 µm

Caprisil CN HPLC Column, 3 µm, 100 Å, CY533-CN x 75 mm

Sign In for Pricing
View Details
ZC12A, ID (ZC3H12A, MCPIP, MCPIP1, Ribonuclease ZC3H12A, MCP-induced protein 1, Zinc finger CCCH domain-containing protein 12A) (MaxLight 405)
MBS6364770-01 0.1 mL

ZC12A, ID (ZC3H12A, MCPIP, MCPIP1, Ribonuclease ZC3H12A, MCP-induced protein 1, Zinc finger CCCH domain-containing protein 12A) (MaxLight 405)

Sign In for Pricing
View Details
ZC12A, ID (ZC3H12A, MCPIP, MCPIP1, Ribonuclease ZC3H12A, MCP-induced protein 1, Zinc finger CCCH domain-containing protein 12A) (MaxLight 405)
MBS6364770-02 5x 0.1 mL

ZC12A, ID (ZC3H12A, MCPIP, MCPIP1, Ribonuclease ZC3H12A, MCP-induced protein 1, Zinc finger CCCH domain-containing protein 12A) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Anti-FGF10 antibody
SL1326R-01 50 µL

Rabbit Anti-FGF10 antibody

Sign In for Pricing
View Details
Rabbit Anti-FGF10 antibody
SL1326R-02 100 µL

Rabbit Anti-FGF10 antibody

Sign In for Pricing
View Details