Human ALKAL2 protein
This Human ALKAL2 protein spans the amino acid sequence from region 25-152aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Augmentor alpha (AUG-alpha) (Protein FAM150B) (FAM150B)
UniProt
Q6UX46
Expression Region
25-152aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Homo sapiens (Human)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1060939-01 0.5 mg (E-Coli)
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
Sign In for Pricing
View Details MBS1060939-02 0.05 mg (Baculovirus)
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
Sign In for Pricing
View Details MBS1060939-03 0.5 mg (Yeast)
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
Sign In for Pricing
View Details MBS1060939-04 0.05 mg (Mammalian-Cell)
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
Sign In for Pricing
View Details MBS1060939-05 1 mg (E-Coli)
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
Sign In for Pricing
View Details MBS1060939-06 0.1 mg (Baculovirus)
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520 (At1g67520), partial
Sign In for Pricing
View Details