Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALKAL2 protein

This Human ALKAL2 protein spans the amino acid sequence from region 25-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmentor alpha (AUG-alpha) (Protein FAM150B) (FAM150B)

UniProt

Q6UX46

Expression Region

25-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFTPA2B, CT (SFTPA2, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B, Pulmonary surfactant-associated protein A2, 35kD pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-5) (MaxLight 650) discontinued
041639-ML650 100 µL

SFTPA2B, CT (SFTPA2, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B, Pulmonary surfactant-associated protein A2, 35kD pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-5) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Ccdc162 3'UTR Lenti-reporter-Luc Vector
15226084 1.0 µg

Ccdc162 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
anti-HBS1L
YF-PA17200 100 ul

anti-HBS1L

Sign In for Pricing
View Details
Hsa-miR-518e-3p miRNA Agomir
orb1921265-01 5 nmol

Hsa-miR-518e-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-518e-3p miRNA Agomir
orb1921265-02 10 nmol

Hsa-miR-518e-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-518e-3p miRNA Agomir
orb1921265-03 20 nmol

Hsa-miR-518e-3p miRNA Agomir

Sign In for Pricing
View Details