Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALKAL2 protein

This Human ALKAL2 protein spans the amino acid sequence from region 25-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmentor alpha (AUG-alpha) (Protein FAM150B) (FAM150B)

UniProt

Q6UX46

Expression Region

25-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MDR1/ABCB1 Antibody (OTI3B2) [DyLight 650]
NBP2-72606C 0.1 mL

Mouse Monoclonal MDR1/ABCB1 Antibody (OTI3B2) [DyLight 650]

Sign In for Pricing
View Details
PRELID3B Antibody, Biotin conjugated
A72108-50UG 50 µg

PRELID3B Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human TP53RK shRNA Plasmid
abx964295-01 150 µg

Human TP53RK shRNA Plasmid

Sign In for Pricing
View Details
Human TP53RK shRNA Plasmid
abx964295-02 300 µg

Human TP53RK shRNA Plasmid

Sign In for Pricing
View Details
Albumin, Bovine Serum (BSA)
367310 1 mg

Albumin, Bovine Serum (BSA)

Sign In for Pricing
View Details
AMPKalpha1 Rabbit Polyclonal Antibody
MBS9465459-01 0.05 mL

AMPKalpha1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details