Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALKAL2 protein

This Human ALKAL2 protein spans the amino acid sequence from region 25-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmentor alpha (AUG-alpha) (Protein FAM150B) (FAM150B)

UniProt

Q6UX46

Expression Region

25-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CBX2 Antibody Picoband® (Dylight488 Conjugate)
A06356-2-Dylight488 100 µg

Anti-CBX2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
UPF1 Rabbit Polyclonal Antibody
orb1545913-01 50 μL

UPF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UPF1 Rabbit Polyclonal Antibody
orb1545913-02 100 µL

UPF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ITGB1BP1 shRNA (UAS) - Lentiviral human ITGB1BP1 shRNA (UAS, iRFP) plasmid
GTR15331663 1 Vial

Lentiviral human ITGB1BP1 shRNA (UAS) - Lentiviral human ITGB1BP1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Olfr1032 Double Nickase Plasmid (m)
sc-434707-NIC 20 µg

Olfr1032 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CTNNB1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0527403 1.0 µg DNA

CTNNB1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details