Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Sindbis virus Structural polyprotein protein

This Insect Sindbis virus Structural polyprotein protein spans the amino acid sequence from region 162-713aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q869C3

Expression Region

162-713aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Anopheles gambiae (African malaria mosquito)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTGSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYR2 Rabbit Polyclonal Antibody (Carrier-free)
orb3119808 100 µg

RYR2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Presenilin 2 Recombinant Rabbit mAb
BS45263-01 50 µL

Presenilin 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Presenilin 2 Recombinant Rabbit mAb
BS45263-02 100 µL

Presenilin 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
GPC4, NT (Glypican-4, K-glypican, Secreted Glypican-4, UNQ474/PRO937) (MaxLight 550) discontinued
G8235-52F-ML550 100 µL

GPC4, NT (Glypican-4, K-glypican, Secreted Glypican-4, UNQ474/PRO937) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SRT 1460 25mg
A19026-25 25 mg

SRT 1460 25mg

Sign In for Pricing
View Details
Rat Negative elongation factor C/D (TH1L) ELISA Kit
MBS7200994-01 48 Well

Rat Negative elongation factor C/D (TH1L) ELISA Kit

Sign In for Pricing
View Details