Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Sindbis virus Structural polyprotein protein

This Insect Sindbis virus Structural polyprotein protein spans the amino acid sequence from region 162-713aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q869C3

Expression Region

162-713aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Anopheles gambiae (African malaria mosquito)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTGSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGF Receptor (Phospho-Tyr1148) Rabbit Polyclonal Antibody
BT-AP09496-01 20 µL

EGF Receptor (Phospho-Tyr1148) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGF Receptor (Phospho-Tyr1148) Rabbit Polyclonal Antibody
BT-AP09496-02 50 µL

EGF Receptor (Phospho-Tyr1148) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGF Receptor (Phospho-Tyr1148) Rabbit Polyclonal Antibody
BT-AP09496-03 100 µL

EGF Receptor (Phospho-Tyr1148) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nup107 Mouse qPCR Template Standard (NM_134010)
MK202263 1 Kit

Nup107 Mouse qPCR Template Standard (NM_134010)

Sign In for Pricing
View Details
FKBP6 shRNA (h) Lentiviral Particles
sc-89491-V 200 µL

FKBP6 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
ZR DNA Sequencing Clean-up Kit™ (200 Preps) w/ Zymo Spin IB
D4051 200 Preparations

ZR DNA Sequencing Clean-up Kit™ (200 Preps) w/ Zymo Spin IB

Sign In for Pricing
View Details