Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Sindbis virus Structural polyprotein protein

This Insect Sindbis virus Structural polyprotein protein spans the amino acid sequence from region 162-713aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q869C3

Expression Region

162-713aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Anopheles gambiae (African malaria mosquito)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTGSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT3L Protein Vector (Human) (pPB-N-His)
PV012890 500 ng

DNMT3L Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rat Monoclonal CD14 Antibody (159010) [PE]
FAB982P 0.5 mL

Rat Monoclonal CD14 Antibody (159010) [PE]

Sign In for Pricing
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 405)
MBS6245007-01 0.1 mL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 405)

Sign In for Pricing
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 405)
MBS6245007-02 5x 0.1 mL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (MaxLight 405)

Sign In for Pricing
View Details
Apg10 (ATG10) (NM_001131028) Human Recombinant Protein
TP720533 10 µg

Apg10 (ATG10) (NM_001131028) Human Recombinant Protein

Sign In for Pricing
View Details
RPSAP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV785117 1.0 µg DNA

RPSAP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details