Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GJA1 protein

This Human GJA1 protein spans the amino acid sequence from region 233-382aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein) (GJAL)

UniProt

P17302

Expression Region

233-382aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine IL-1RA (Interleukin 1 Receptor Antagonist) ELISA Kit
ECa27273 96 Tests

Canine IL-1RA (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
MBS2050256-01 0.1 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
MBS2050256-02 0.2 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
MBS2050256-03 0.5 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
MBS2050256-04 1 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
MBS2050256-05 5 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details