Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Gja1 protein

This Mouse Gja1 protein spans the amino acid sequence from region 232-382aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein) (Cxn-43)

UniProt

P23242

Expression Region

232-382aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AGAP3 shRNA (UAS) - Lentiviral human AGAP3 shRNA (UAS, RFP) (100)
GTR15351183 1 Vial

Lentiviral human AGAP3 shRNA (UAS) - Lentiviral human AGAP3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CARD10 Protein Vector (Mouse) (pPM-C-HA)
PV161560 500 ng

CARD10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human SH3PXD2B Knockout HEK293T cell line
GTR15418115 1 Vial

Human SH3PXD2B Knockout HEK293T cell line

Sign In for Pricing
View Details
Lentiviral human PTX3 shRNA (UAS) - Lentiviral human PTX3 shRNA (UAS) (25)
GTR15349316 1 Vial

Lentiviral human PTX3 shRNA (UAS) - Lentiviral human PTX3 shRNA (UAS) (25)

Sign In for Pricing
View Details
S100 beta Polyclonal Antibody
MBS2541728-01 0.02 mL

S100 beta Polyclonal Antibody

Sign In for Pricing
View Details
S100 beta Polyclonal Antibody
MBS2541728-02 0.06 mL

S100 beta Polyclonal Antibody

Sign In for Pricing
View Details