Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lox protein

This Mouse Lox protein spans the amino acid sequence from region 163-411aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lysyl oxidase (Ras excision protein) (Rrg)

UniProt

P28301

Expression Region

163-411aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP12 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07426 0.1 mg

AKAP12 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (PE)
MBS6454995-01 0.2 mL

CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (PE)

Sign In for Pricing
View Details
CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (PE)
MBS6454995-02 5x 0.2 mL

CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (PE)

Sign In for Pricing
View Details
GAL Rabbit Polyclonal Antibody (APC)
orb1002957 100 µL

GAL Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Ethyl 4-oxo-2- (trifluoromethyl) cyclohexane-1-carboxylate
MKD93672-01 50 mg

Ethyl 4-oxo-2- (trifluoromethyl) cyclohexane-1-carboxylate

Sign In for Pricing
View Details
Ethyl 4-oxo-2- (trifluoromethyl) cyclohexane-1-carboxylate
MKD93672-02 0.5 g

Ethyl 4-oxo-2- (trifluoromethyl) cyclohexane-1-carboxylate

Sign In for Pricing
View Details