Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALKAL1 protein

This Human ALKAL1 protein spans the amino acid sequence from region 28-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmentor beta (AUG-beta) (Protein FAM150A) (FAM150A)

UniProt

Q6UXT8

Expression Region

28-129aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF405S conjugate, 0.1mg/mL
BNC042336-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal DEC2/SHARP1 Antibody [mFluor Violet 610 SE]
NBP1-19613MFV610 0.1 mL

Rabbit Polyclonal DEC2/SHARP1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
b9HSP (HSPB9) (NM_033194) Human Recombinant Protein
TP310903 20 µg

b9HSP (HSPB9) (NM_033194) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human PAICS shRNA (UAS) - Lentiviral human PAICS shRNA (UAS) (25)
GTR15103925 1 Vial

Lentiviral human PAICS shRNA (UAS) - Lentiviral human PAICS shRNA (UAS) (25)

Sign In for Pricing
View Details
N-Nitroso Phenylephrine EP Impurity C
CS-O-63995 1 Each

N-Nitroso Phenylephrine EP Impurity C

Sign In for Pricing
View Details
SMAD3 Antibody
OAAN02322-50UL 50 µL

SMAD3 Antibody

Sign In for Pricing
View Details