Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GCGR protein

This Human GCGR protein spans the amino acid sequence from region 26-136aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GL-R)

UniProt

P47871

Expression Region

26-136aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.

Form

Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse IL-17A Antibody
MBS4516223-01 0.025 mg

APC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody
MBS4516223-02 0.05 mg

APC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody
MBS4516223-03 0.1 mg

APC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody
MBS4516223-04 0.2 mg

APC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody
MBS4516223-05 5x 0.2 mg

APC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
TRNAN20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2508408 1.0 µg DNA

TRNAN20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details