Human GIPR protein
This Human GIPR protein spans the amino acid sequence from region 22-138aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Glucose-dependent insulinotropic polypeptide receptor ()
UniProt
P48546
Expression Region
22-138aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Epigenetics, GPCR, Neuroscience, Signaling Pathways
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS281840-01 48 Tests
Mouse Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) ELISA Kit
Sign In for Pricing
View Details MBS281840-02 96 Tests
Mouse Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) ELISA Kit
Sign In for Pricing
View Details MBS281840-03 5x 96 Tests
Mouse Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) ELISA Kit
Sign In for Pricing
View Details MBS281840-04 10x 96 Tests
Mouse Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) ELISA Kit
Sign In for Pricing
View Details 
