Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pkdcc protein

This Mouse Pkdcc protein spans the amino acid sequence from region 33-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase domain-containing protein, cytoplasmic (Protein kinase-like protein SgK493) (Sugen kinase 493) (Vertebrate lonesome kinase) (Sgk493) (Vlk)

UniProt

Q5RJI4

Expression Region

33-492aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRPGQSPGSSAAPGPGRRGGRGELARQIRERYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLQRPRPPRVRSPPDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFRSGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQCRAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,3,3-Tetrafluoro-1-Iodopropane
T04390 10 g

2,2,3,3-Tetrafluoro-1-Iodopropane

Sign In for Pricing
View Details
HLCS Knockout HT29 Polyclonal Cells
ARG33354 1 Million

HLCS Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
NP (Nucleoside Phosphorylase, FLJ94043, FLJ97288, FLJ97312, MGC117396, MGC125915, MGC125916, PNP, PRO1837, PUNP) (MaxLight 550)
249414-ML550 100 µL

NP (Nucleoside Phosphorylase, FLJ94043, FLJ97288, FLJ97312, MGC117396, MGC125915, MGC125916, PNP, PRO1837, PUNP) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Nop53 shRNA (UAS) - Lentiviral mouse Nop53 shRNA (UAS, RFP) plasmid
GTR15299272 1 Vial

Lentiviral mouse Nop53 shRNA (UAS) - Lentiviral mouse Nop53 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TP63 (Tumor Protein 63, p63, Chronic Ulcerative Stomatitis Protein, CUSP, Keratinocyte Transcription Factor KET, Transformation-related Protein 63, Tumor Protein p73-like, p73L, p40, p51, KET, P63, P73H, P73L, TP73L) (MaxLight 405) discontinued
138460-ML405 100 µL

TP63 (Tumor Protein 63, p63, Chronic Ulcerative Stomatitis Protein, CUSP, Keratinocyte Transcription Factor KET, Transformation-related Protein 63, Tumor Protein p73-like, p73L, p40, p51, KET, P63, P73H, P73L, TP73L) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum 6-phosphogluconolactonase (pgl)
MBS1021475-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum 6-phosphogluconolactonase (pgl)

Sign In for Pricing
View Details