Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A33R protein

This Virus A33R protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

A33RProtein A33

UniProt

P68616

Expression Region

57-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf158 Rabbit Polyclonal Antibody (APC-Cy7)
orb2521661 100 µL

C1orf158 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
EDNRA 3'UTR GFP Stable Cell Line
TU056567 1.0 mL

EDNRA 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
BRCA1 Antibody / Breast Cancer Marker
V5544-100UG 100 µg

BRCA1 Antibody / Breast Cancer Marker

Sign In for Pricing
View Details
Beta Catenin Mouse Monoclonal Antibody
AMM85025-01 1 Each

Beta Catenin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Beta Catenin Mouse Monoclonal Antibody
AMM85025-02 50 µL

Beta Catenin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Beta Catenin Mouse Monoclonal Antibody
AMM85025-03 100 µL

Beta Catenin Mouse Monoclonal Antibody

Sign In for Pricing
View Details