Virus A33R protein
This Virus A33R protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
A33RProtein A33
UniProt
P68616
Expression Region
57-185aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Vaccinia virus (strain Copenhagen) (VACV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7224962-01 48 Well
Mouse AP-1 complex subunit mu-1 (AP1M1) ELISA Kit
Sign In for Pricing
View Details MBS7224962-02 96 Well
Mouse AP-1 complex subunit mu-1 (AP1M1) ELISA Kit
Sign In for Pricing
View Details MBS7224962-03 5x 96 Well
Mouse AP-1 complex subunit mu-1 (AP1M1) ELISA Kit
Sign In for Pricing
View Details MBS7224962-04 10x 96 Well
Mouse AP-1 complex subunit mu-1 (AP1M1) ELISA Kit
Sign In for Pricing
View Details 
MBS649936-01 0.05 mg
TUBB3, CT (Tubulin beta-3 Chain, Tubulin beta-4 Chain, Tubulin beta-III, TUBB4)
Sign In for Pricing
View Details