Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate OSM protein

This Primate OSM protein spans the amino acid sequence from region 1-231aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

F7GF43

Expression Region

1-231aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit
MBS2087334-01 24 Strip Well

General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit
MBS2087334-02 48 Well

General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit
MBS2087334-03 96 Well

General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit
MBS2087334-04 5x 96 Well

General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit
MBS2087334-05 10x 96 Well

General Adenosine Triphosphate (ATP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
(2-Methylbenzyl) hydrazine hydrochloride
JSB62606 2.5 g

(2-Methylbenzyl) hydrazine hydrochloride

Sign In for Pricing
View Details