Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GCGR protein

This Human GCGR protein spans the amino acid sequence from region 26-136aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GL-R

UniProt

P47871

Expression Region

26-136aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit
MBS9301876-01 48 Well

Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit

Sign In for Pricing
View Details
Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit
MBS9301876-02 96 Well

Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit

Sign In for Pricing
View Details
Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit
MBS9301876-03 5x 96 Well

Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit

Sign In for Pricing
View Details
Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit
MBS9301876-04 10x 96 Well

Mouse lymphocyte function associated antigen 3, (LFA-3/CD58) ELISA Kit

Sign In for Pricing
View Details
FE65 Recombinant Antibody, Cy5.5 Conjugated
bsm-62200R-Cy5.5 100 µL

FE65 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Mynn Antibody
orb860593 2 mg

Mynn Antibody

Sign In for Pricing
View Details