Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Apolipoprotein E protein

This Mouse Apolipoprotein E protein spans the amino acid sequence from region 19-311aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo-E

UniProt

P08226

Expression Region

19-311aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM120B CRISPR/Cas9 KO Plasmid (h)
sc-414539 20 µg

TMEM120B CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
RAB41 (NM_001032726) Human Tagged Lenti ORF Clone
RC214913L4 10 µg

RAB41 (NM_001032726) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OR5M10 AAV Vector (Human) (CMV)
35460101 1 µg

OR5M10 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) Rabbit Polyclonal Antibody
TA377906 100 µL

Cytokeratin 14 (KRT14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-DYNLT3 antibody
STJ119285 100 µl

Anti-DYNLT3 antibody

Sign In for Pricing
View Details
Anti-XRCC1 Antibody Picoband®, PE Conjugate
PA1639-PE 100 µg/Vial

Anti-XRCC1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details