Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISCU protein

This Human ISCU protein spans the amino acid sequence from region 35-167aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

UniProt

Q9H1K1

Expression Region

35-167aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein
abx652638-01 10 µg

Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein

Sign In for Pricing
View Details
Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein
abx652638-02 50 µg

Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein

Sign In for Pricing
View Details
Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein
abx652638-03 100 µg

Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein

Sign In for Pricing
View Details
Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein
abx652638-04 200 µg

Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein

Sign In for Pricing
View Details
Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein
abx652638-05 500 µg

Human Basic Salivary Proline Rich Protein 2 (PRB2) Protein

Sign In for Pricing
View Details
OR5B12 Mouse Monoclonal Antibody
orb1473703-01 30 µL

OR5B12 Mouse Monoclonal Antibody

Sign In for Pricing
View Details