Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PML protein

This Human PML protein spans the amino acid sequence from region 59-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Promyelocytic leukemia protein (RING finger protein 71) (Tripartite motif-containing protein 19) (MYL) (PP8675) (RNF71) (TRIM19)

UniProt

P29590

Expression Region

59-239aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhac2 (NM_001003672) Mouse Tagged ORF Clone Lentiviral Particle
MR221191L4V 200 µL

Pcdhac2 (NM_001003672) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-PPFIA1 Antibody Picoband®, FITC Conjugate
A05735-1-FITC 100 µg/Vial

Anti-PPFIA1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Rat Tgs1 Pre-designed siRNA Set B
SI214475B 1 Each

Rat Tgs1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Mtus1 shRNA (UAS) - Lentiviral mouseMtus1 shRNA (UAS, GFP) (25)
GTR15262076 1 Vial

Lentiviral mouse Mtus1 shRNA (UAS) - Lentiviral mouseMtus1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Ksr-1 (Phospho-Ser392) Antibody
orb2628551 100 µL

Ksr-1 (Phospho-Ser392) Antibody

Sign In for Pricing
View Details
Anti-MAB21L1 Polyclonal Antibody
TMAB-08489-01 50 μL

Anti-MAB21L1 Polyclonal Antibody

Sign In for Pricing
View Details