Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ASIP protein

This Bovine ASIP protein spans the amino acid sequence from region 23-133aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Agouti switch protein (ASP)

UniProt

Q29414

Expression Region

23-133aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human gAdiponectin/gAcrp30 CF
1688-AC-025 25 µg

Recombinant Human gAdiponectin/gAcrp30 CF

Sign In for Pricing
View Details
Lentiviral human SPATA22 sgRNA gene knockout kit - Lentiviral human SPATA22 sgRNA gene knockout kit (25)
GTR15374097 1 Vial

Lentiviral human SPATA22 sgRNA gene knockout kit - Lentiviral human SPATA22 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
DFFA antibody
10R-3823 100 µL

DFFA antibody

Sign In for Pricing
View Details
POM121L8P Protein Lysate (Human) with C-Ha Tag
37219031 100 µg

POM121L8P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lentiviral human RNPEPL1 sgRNA gene knockout kit - Lentiviral human RNPEPL1 sgRNA gene knockout kit (100)
GTR15375982 1 Vial

Lentiviral human RNPEPL1 sgRNA gene knockout kit - Lentiviral human RNPEPL1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Ctag2 siRNA Oligos set (Rat)
17021176 3x 5 nmol

Ctag2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details