Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ASIP protein

This Bovine ASIP protein spans the amino acid sequence from region 23-133aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Agouti switch protein (ASP)

UniProt

Q29414

Expression Region

23-133aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti GGT1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul
IRBAMLGGT1AP265200UL 200 µL

Rabbit Anti GGT1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul

Sign In for Pricing
View Details
Lentiviral human SCAMP1 shRNA (UAS) - Lentiviral human SCAMP1 shRNA (UAS, iRFP) plasmid
GTR15334027 1 Vial

Lentiviral human SCAMP1 shRNA (UAS) - Lentiviral human SCAMP1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-GDNF Receptor alpha 1/GFRA1 Antibody Picoband® (APC Conjugate)
PB9202-APC 100 µg/Vial

Anti-GDNF Receptor alpha 1/GFRA1 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
all-trans-3,4-Didehydro Retinoic Acid
TRC-D439400-25MG 25 mg

all-trans-3,4-Didehydro Retinoic Acid

Sign In for Pricing
View Details
Recombinant Populus trichocarpa Protein psbN (psbN), partial
MBS1073745-01 0.5 mg (E-Coli)

Recombinant Populus trichocarpa Protein psbN (psbN), partial

Sign In for Pricing
View Details
Recombinant Populus trichocarpa Protein psbN (psbN), partial
MBS1073745-02 0.05 mg (Baculovirus)

Recombinant Populus trichocarpa Protein psbN (psbN), partial

Sign In for Pricing
View Details