Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pla2g12a protein

This Mouse Pla2g12a protein spans the amino acid sequence from region 26-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (Pla2g12)

UniProt

Q9EPR2

Expression Region

26-192aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IOX1
OOAU00092-5MG 5 mg

IOX1

Sign In for Pricing
View Details
N'- (5-bromo-4-methylpyridin-2-yl) -N, N-dimethylformimidamide
OR1088563-01 250 mg

N'- (5-bromo-4-methylpyridin-2-yl) -N, N-dimethylformimidamide

Sign In for Pricing
View Details
N'- (5-bromo-4-methylpyridin-2-yl) -N, N-dimethylformimidamide
OR1088563-02 500 mg

N'- (5-bromo-4-methylpyridin-2-yl) -N, N-dimethylformimidamide

Sign In for Pricing
View Details
N'- (5-bromo-4-methylpyridin-2-yl) -N, N-dimethylformimidamide
OR1088563-03 1 g

N'- (5-bromo-4-methylpyridin-2-yl) -N, N-dimethylformimidamide

Sign In for Pricing
View Details
Ccnt1 Mouse shRNA Plasmid (Locus ID 12455)
TL519029 1 Kit

Ccnt1 Mouse shRNA Plasmid (Locus ID 12455)

Sign In for Pricing
View Details
Lsk shRNA (h) Lentiviral Particles
sc-38973-V 200 µL

Lsk shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details