Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pla2g12a protein

This Mouse Pla2g12a protein spans the amino acid sequence from region 26-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (Pla2g12)

UniProt

Q9EPR2

Expression Region

26-192aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Inhibin Beta A Chain (INHBA) CLIA Kit
abx492114-01 96 Tests

Rat Inhibin Beta A Chain (INHBA) CLIA Kit

Sign In for Pricing
View Details
Rat Inhibin Beta A Chain (INHBA) CLIA Kit
abx492114-02 5x 96 Tests

Rat Inhibin Beta A Chain (INHBA) CLIA Kit

Sign In for Pricing
View Details
Rat Inhibin Beta A Chain (INHBA) CLIA Kit
abx492114-03 10x 96 Tests

Rat Inhibin Beta A Chain (INHBA) CLIA Kit

Sign In for Pricing
View Details
PDE3A Antibody
E38QA5422 100 µL

PDE3A Antibody

Sign In for Pricing
View Details
SMPD1 Protein Vector (Human) (pPB-N-His)
PV039238 500 ng

SMPD1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
L-Glucono-1,5-lactone
BIG1121-01 100 mg

L-Glucono-1,5-lactone

Sign In for Pricing
View Details