Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pla2g12a protein

This Mouse Pla2g12a protein spans the amino acid sequence from region 26-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (Pla2g12)

UniProt

Q9EPR2

Expression Region

26-192aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,6-Dimethyl-phenanthrene
411467 2.5 mg

1,6-Dimethyl-phenanthrene

Sign In for Pricing
View Details
Tryptophan 5-hydroxylase 2
AP89071 1 mg

Tryptophan 5-hydroxylase 2

Sign In for Pricing
View Details
Unc5c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3723006 1.0 µg DNA

Unc5c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ZDHHC23 ORF Vector (Human) (pORF)
50799011 1.0 µg DNA

ZDHHC23 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SH3GL2/Endophilin A1 Rabbit pAb, BF700 conjugated
orb2865916 100 µL

SH3GL2/Endophilin A1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Anti-GnRH-Receptor / LH-RH Receptor Monoclonal Antibody
M01442 100 µg

Anti-GnRH-Receptor / LH-RH Receptor Monoclonal Antibody

Sign In for Pricing
View Details