Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM119 protein

This Human TMEM119 protein spans the amino acid sequence from region 26-96aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osteoblast induction factor (OBIF)

UniProt

Q4V9L6

Expression Region

26-96aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4galt7 (NM_146045) Mouse Over-expression Lysate
LC704794 20 µg

B4galt7 (NM_146045) Mouse Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD11a Antibody[I21/7]
AN00573L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD11a Antibody[I21/7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD11a Antibody[I21/7]
AN00573L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD11a Antibody[I21/7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD11a Antibody[I21/7]
AN00573L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD11a Antibody[I21/7]

Sign In for Pricing
View Details
NSC 226895
TRC-N712213-50MG 50 mg

NSC 226895

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF640R conjugate, 0.1mg/mL
BNC402622-100 1x 100 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details