Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM119 protein

This Human TMEM119 protein spans the amino acid sequence from region 26-96aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osteoblast induction factor (OBIF)

UniProt

Q4V9L6

Expression Region

26-96aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aranthol Maleate
TRC-A765550-1G 1 g

Aranthol Maleate

Sign In for Pricing
View Details
(Z)-11-Octadecenoic Acid (Solution in Ethanol)
TRC-O860075-250MG 250 mg

(Z)-11-Octadecenoic Acid (Solution in Ethanol)

Sign In for Pricing
View Details
CDH4 Antibody
8C12102-AAT 50 µg

CDH4 Antibody

Sign In for Pricing
View Details
CTNNBL1 Polyclonal Antibody
E-AB-14901-01 20 µL

CTNNBL1 Polyclonal Antibody

Sign In for Pricing
View Details
CTNNBL1 Polyclonal Antibody
E-AB-14901-02 60 µL

CTNNBL1 Polyclonal Antibody

Sign In for Pricing
View Details
CTNNBL1 Polyclonal Antibody
E-AB-14901-03 120 µL

CTNNBL1 Polyclonal Antibody

Sign In for Pricing
View Details