Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

P21115

Expression Region

18-279aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL
BNC040738-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), Biotin conjugate, 0.1mg/mL
BNCB2809-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF568 conjugate, 0.1mg/mL
BNC683640-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF555 conjugate, 0.1mg/mL
BNC551366-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF740 conjugate, 0.1mg/mL
BNC742265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fmoc-D-Orn (Boc) TentaGel® S AC Resin
SAD1120.5G 5 g

Fmoc-D-Orn (Boc) TentaGel® S AC Resin

Sign In for Pricing
View Details